PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_12792-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 311aa    MW: 33626.6 Da    PI: 9.5413
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_12792-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.34.4e-15263306548
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                      +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN++Lkk+
  TRIUR3_12792-P1 263 RRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENERLKKQ 306
                      69***************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.0E-9259310IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.4E-15261306No hitNo description
PROSITE profilePS5021711.829261311IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.06E-10263306No hitNo description
CDDcd147074.03E-24263308No hitNo description
PfamPF001704.5E-13263306IPR004827Basic-leucine zipper domain
PROSITE patternPS000360266281IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MASQPGRGTG GGGDAGTSQR GQVQSLARQG SLYSLTLDEV QNHLGEPLQS MNLDELLRTV  60
FPDDMEPDGA TTSQYVPSSS LLRQGSITMP TELSKKTVDE VWKGIQDAPK RSVQGSGRRK  120
RERQPTLGEM TLEDFLVQAG VVSQGFLKDT SDAGNLGLVG REATAAGAAD LTSGAQWLGH  180
YQQQIAAAAI DTHQHGQQIV PAAYMPIQFV PQPLNVVGPG ATLGSAYSDG QSTSPMISPI  240
SDSQTPGRKR GVSGDVPNKF VERRQKRMIK NRESAARSRA RKQAYTNELE NKVSRLEEEN  300
ERLKKQKVNV Q
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1116123GRRKRERQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00409DAPTransfer from AT3G56850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3739190.0AK373919.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3047H22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014754827.11e-174PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_014754826.11e-174PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9LES33e-74AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLM7ZCA70.0M7ZCA7_TRIUA; ABSCISIC ACID-INSENSITIVE 5-like protein 2
STRINGMLOC_16096.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27073883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.16e-75ABA-responsive element binding protein 3